Cat#:RP-5237H;Product Name:Recombinant Protein G;Description:Recombinant streptococcal protein G lacking the albumin binding region thereby avoiding undesirable reactions with albumin, though the Fc binding domain is still present. The recombinant Protein G is produced in Escherichia coli using sequence from Streptococcus C1-C2-C3. The Protein G contains 200 amino acids (190-384 and five additional residues not including methionine) having a molecular mass of 21.8kDa. The Protein-G migrates on SDS-PAGE around 32kDa.;Source:E.coli;AA Sequence:LPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE.;Purity:Greater than 96% as determined by SDS-PAGE and RP-HPLC.;Formulation:Lyophilized white powder containing no additives.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:Reconstitution with deionized water or PBS.;