Cat#: | RP-1102RC |
Product Name: | Recombinant Rhesus IFNAR1 / IFNAR Protein (Fc Tag) |
Synonym: | IFNAR1 |
Description: | A DNA sequence encoding the rhesus IFNAR1 (NP_001253442.1) (Met1-Lys437) was expressed with the Fc region of human IgG1 at the C-terminus. |
Source: | Human Cells |
Predicted N Terminal: | Ala 25 |
AA Sequence: | DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH. |
Molecular Characterization: | The recombinant rhesus IFNAR1 comprises 654 amino acids and has a calculated molecular mass of 74.5 KDa. |
Endotoxin: | < 1.0 EU per ug of the protein as determined by the LAL method |
Purity: | Greater than 95 % as determined by SDS-PAGE |
Bioactivity: | Please contact us for detailed information |
Formulation: | Lyophilized from sterile PBS, pH 7.4. |
Stability: | Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃ |
Reconstitution: | Please see related COA for specific instructions. |
Storage: | Avoid repeated freeze-thaw cycles. In lyophilized state for 1 year (4-8℃); Upon reconstitution under sterile conditions for 2 weeks (4-8℃) or 3 months (-20℃ to -70℃). |