Cat#: | RP-031MS |
Product Name: | Recombinant Mouse Ccl8 Protein, GST Tag |
Synonym: | Small inducible cytokine A8, CCL8, Monocyte chemotactic protein 2, MCP-2, Monocyte chemoattractant protein 2, HC14, chemokine (C-C motif) ligand 8, MCP2, SCYA8, SCYA10, AB023418, 1810063B20Rik. |
Gene Introduction: | Gene ID: 20307. Official Symbol: Ccl8. Official Full Name is chemokine (C-C motif) ligand 8. Mouse CCL8 is a CC chemokine of the monocyte chemoattractant protein (MCP) family whose biological activity and receptor usage have remained elusive. |
Description: | Mouse CCL8 protein produced in E.coli, was fused with GST Tag at N terminal. |
Source: | E. coli |
AA Sequence: | LLIAVPVSPEKLTGPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP |
Formulation: | Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0) and 10% glycerol. |
Stability: | Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃ |
Reconstitution: | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. |
Host Species: | Human |
Storage: | Short-term storage: Store at 2-8°C for two weeks. Long-term storage: Aliquot and store at -20°C to -80°C for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
References: | Upregulation of plasma CCL8 in mouse model of graft-vs-host disease. Ota A, et al. Exp Hematol, 2009 Apr. PMID 19302923 |