• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Mouse Proteins >

Recombinant Mouse Ccl8 Protein, GST Tag Online Inquiry

Cat#:RP-031MS
Product Name:Recombinant Mouse Ccl8 Protein, GST Tag
Synonym: Small inducible cytokine A8, CCL8, Monocyte chemotactic protein 2, MCP-2, Monocyte chemoattractant protein 2, HC14, chemokine (C-C motif) ligand 8, MCP2, SCYA8, SCYA10, AB023418, 1810063B20Rik.
Gene Introduction: Gene ID: 20307. Official Symbol: Ccl8. Official Full Name is chemokine (C-C motif) ligand 8. Mouse CCL8 is a CC chemokine of the monocyte chemoattractant protein (MCP) family whose biological activity and receptor usage have remained elusive.
Description: Mouse CCL8 protein produced in E.coli, was fused with GST Tag at N terminal.
Source: E. coli
AA Sequence: LLIAVPVSPEKLTGPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP
Formulation: Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0) and 10% glycerol.
Stability: Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃
Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Host Species: Human
Storage: Short-term storage: Store at 2-8°C for two weeks. Long-term storage: Aliquot and store at -20°C to -80°C for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
References: Upregulation of plasma CCL8 in mouse model of graft-vs-host disease. Ota A, et al. Exp Hematol, 2009 Apr. PMID 19302923
  • Pre product:Recombinant Mouse Cd3e Protein, GST Tag-Advanced Biomart
  • Online Inquiry

    refresh