Cat#:RP-9170H;Product Name:Recombinant Human EGF Protein, GST Tag;Description:Recombinant human EGF protein expressed in E.coli has the molecular weight at 6.2kDa. The egf recombinant protein is purified using our unique techniques.;Source:E. coli;AA Sequence:NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR ;Molecular Characterization:6.2kDa;Formulation:Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0) and 10% glycerol.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. ;Storage:Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.;