Cat#: | RPH-NP270 |
Product Name: | Recombinant Human Leukocyte Ig-Like Receptor A2 / LILRA2 / ILT1 / CD85h Protein |
Synonym: | Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 2, CD85 Antigen-Like Family Member H, Immunoglobulin-Like Transcript 1, ILT-1, Leukocyte Immunoglobulin-Like Receptor 7, LIR-7, CD85h, LILRA2, ILT1, LIR7 |
Description: | Recombinant Human LILRA2 Protein is produced in Human Cells and the target gene encoding Gly24-Ser420 is expressed with a His tag at the C-terminus. |
Source: | Human Cells |
AA Sequence: | GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSIT WEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFI LCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVP GVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLG PVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRG QFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPL ELVVSASVDHHHHHH |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin: | < 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Formulation: | Recombinant Human Leukocyte Ig-Like Receptor A2/LILRA2/ILT1/CD85h Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
Stability: | Recombinant Human Leukocyte Ig-Like Receptor A2/LILRA2/ILT1/CD85h Protein is stable for up to 1 year from date of receipt at -70℃. |
Reconstitution: | Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Usage: | For Lab Research Use Only |
Storage: | Lyophilized recombinant human LILRA2 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human LILRA2 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human LILRA2 protein samples are stable below -20°C for 3 months. |