• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human KIR2DL4 / CD158d / KIR103 Protein Online Inquiry

Cat#:RPH-NP265
Product Name:Recombinant Human KIR2DL4 / CD158d / KIR103 Protein
Synonym: Killer Cell Immunoglobulin-Like Receptor 2DL4, CD158 Antigen-Like Family Member D, G9P, Killer Cell Inhibitory Receptor 103AS, KIR-103AS, MHC Class I NK Cell Receptor KIR103AS, CD158d, KIR2DL4, CD158D, KIR103AS
Description: Recombinant Human KIR2DL4 Protein is produced in Human Cells and the target gene encoding Trp22-His242 is expressed with a His tag at the C-terminus.
Source: Human Cells
AA Sequence: WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISP VTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSS FDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVS VTGNPSSSWPSPTEPSFKTGIARHLHVDHHHHHH
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin: < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation: Recombinant Human KIR2DL4/CD158d/KIR103 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Stability: Recombinant Human KIR2DL4/CD158d/KIR103 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution: Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage: For Lab Research Use Only
Storage: Lyophilized recombinant human KIR2DL4 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human KIR2DL4 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human KIR2DL4 protein samples are stable below -20°C for 3 months.

Online Inquiry

refresh