Cat#:RPH-NP264;Product Name:Recombinant Human KIR2DL3 / NKAT2 / CD158b2 Protein;Synonym:Killer cell immunoglobulin-like receptor 2DL3, KIR2DL3, CD158b2, NKAT2, CD158 antigen-like family member B2, KIR-023GB, Killer inhibitory receptor cl 2-3, MHC class I NK cell receptor, NKAT-2, p58 NK receptor CL-6;Description:Recombinant Human KIR2DL3 Protein is produced in Human Cells and the target gene encoding His22-His245 is expressed with a Fc tag at the C-terminus.;Source:Human Cells;AA Sequence:HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFS IGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSS RSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPL LVSVTGNPSNSWLSPTEPSSETGNPRHLHVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFL FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGK;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human KIR2DL3/NKAT2/CD158b2 Protein was lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.;Stability:Recombinant Human KIR2DL3/NKAT2/CD158b2 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human KIR2DL3 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human KIR2DL3 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human KIR2DL3 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;