Cat#:RPH-NP257;Product Name:Recombinant Human Interleukin-9 / IL9 / Cytokine P40 Protein;Synonym:Interleukin-9, IL-9, Cytokine P40, T-Cell Growth Factor P40, IL9;Description:Recombinant Human Interleukin-9 Protein is produced in Human Cells and the target gene encoding Glu19-Ile144 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQT RYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKIVDHH HHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Interleukin-9/IL9/Cytokine P40 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human Interleukin-9/IL9/Cytokine P40 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IL9 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL9 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human IL9 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;