Cat#:RPH-NP256;Product Name:Recombinant Human Interleukin-8 / IL8 Protein(Ser28-Ser99);Synonym:Interleukin-8, IL-8, C-X-C Motif Chemokine 8, Emoctakin, Granulocyte Chemotactic Protein 1, GCP-1, Monocyte-Derived Neutrophil Chemotactic Factor, MDNCF, Monocyte-Derived Neutrophil-Activating Peptide, MONAP, Neutrophil-Activating Protein 1, NAP-1, Protein 3-10C, T-Cell Chemotactic Factor, IL8, CXCL8;Description:Recombinant Human Interleukin-8 Protein is produced in E.coli and the target gene encoding Ser28-Ser99 is expressed.;Source:E.coli;AA Sequence:SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKF LKRAENS;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Bioactivity:ED50 is less than 2 ng/ml. Specific Activity of 5.0 x 10^5 IU/mg.;Formulation:Recombinant Human Interleukin-8/IL8 Protein (Ser28-Ser99)was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.;Stability:Recombinant Human Interleukin-8/IL8 Protein (Ser28-Ser99)is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IL8 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL8 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human IL8 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;