Cat#:RPH-NP244;Product Name:Recombinant Human Interleukin-36γ / IL-36γ / IL1F9 Protein;Synonym:Interleukin-36 gamma, IL36G, IL-1-related protein 2, IL-1RP2, IL-1 epsilon, IL-1F9, Interleukin-1 homolog 1, IL-1H1;Description:Recombinant Human Interleukin-36 gamma Protein is produced in E.coli and the target gene encoding Ser18-Asp169 is expressed.;Source:E.coli;AA Sequence:SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNP EMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQ PIILTSELGKSYNTAFELNIND;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Interleukin-36γ/IL-36γ/IL1F9 Protein was lyophilized from a 0.2 μm filtered solution of 20mM Tris,100mM Nacl,0.1mM EDTA,pH8.0.;Stability:Recombinant Human Interleukin-36γ/IL-36γ/IL1F9 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IL-36γ protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL-36γ protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human IL-36γ protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;