Cat#:RPH-NP243;Product Name:Recombinant Human Interleukin-36α / IL36α Protein;Synonym:Interleukin-36 Alpha, FIL1 Epsilon, Interleukin-1 Epsilon, IL-1 Epsilon, Interleukin-1 Family Member 6, IL-1F6, IL36A, FIL1E, IL1E, IL1F6;Description:Recombinant Human Interleukin-36 alpha Protein is produced in E.coli and the target gene encoding Met1-Phe158 is expressed.;Source:E.coli;AA Sequence:MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYL GLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAV SSEGGCPLILTQELGKANTTDFGLTMLF;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Interleukin-36α/IL36α Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.;Stability:Recombinant Human Interleukin-36α/IL36α Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IL36α protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL36α protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human IL36α protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;