Cat#:RPH-NP240;Product Name:Recombinant Human Interleukin-33 / IL33 Protein;Synonym:Interleukin-33, IL-33, Interleukin-1 Family Member 11, IL-1F11, Nuclear Factor From High Endothelial Venules, NF-HEV, IL33, C9orf26, IL1F11, NFHEV;Description:Recombinant Human Interleukin-33 Protein is produced in E.coli and the target gene encoding Ser112-Thr270 is expressed.;Source:E.coli;AA Sequence:MSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGD GVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFI GVKDNHLALIKVDSSENLCTENILFKLSET;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Interleukin-33/IL33 Protein was lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.;Stability:Recombinant Human Interleukin-33/IL33 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IL33 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL33 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human IL33 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;