• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human Interleukin-28B / IL28B / IFN-lambda 3 Protein Online Inquiry

Cat#:RPH-NP236
Product Name:Recombinant Human Interleukin-28B / IL28B / IFN-lambda 3 Protein
Synonym: Interleukin-28B; IL-28B; Cytokine Zcyto22; Interferon Lambda-3; IFN-Lambda-3; Interferon Lambda-4; IFN-Lambda-4; Interleukin-28C; IL-28C; IL28B; IFNL3; IFNL4; IL28C; ZCYTO22
Description: Recombinant Human Interleukin-28B Protein is produced in Human Cells and the target gene encoding Val22-Val196 is expressed.
Source: Human Cells
AA Sequence: VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQ VRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRL HHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin: < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation: Recombinant Human Interleukin-28B/IL28B/IFN-lambda 3 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,1mM EDTA,pH7.4.
Stability: Recombinant Human Interleukin-28B/IL28B/IFN-lambda 3 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution: Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage: For Lab Research Use Only
Storage: Lyophilized recombinant human IL28B protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL28B protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human IL28B protein samples are stable below -20°C for 3 months.

Online Inquiry

refresh