Cat#: | RPH-NP235 |
Product Name: | Recombinant Human Interleukin-28B / IL28B / IFN-lambda 3 Protein |
Synonym: | Interleukin-28B, IL-28B, Cytokine Zcyto22, Interferon Lambda-3, IFN-Lambda-3, Interferon Lambda-4, IFN-Lambda-4, Interleukin-28C, IL-28C, IL28B, IFNL3, IFNL4, IL28C, ZCYTO22 |
Description: | Recombinant Human Interleukin-28B Protein is produced in Human Cells and the target gene encoding Val22-Val196 is expressed with a His tag at the C-terminus. |
Source: | Human Cells |
AA Sequence: | VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQ VRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRL HHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCVVDHHHHHH |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin: | < 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Formulation: | Recombinant Human Interleukin-28B/IL28B/IFN-lambda 3 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,1mM EDTA,pH7.4. |
Stability: | Recombinant Human Interleukin-28B/IL28B/IFN-lambda 3 Protein is stable for up to 1 year from date of receipt at -70℃. |
Reconstitution: | Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Usage: | For Lab Research Use Only |
Storage: | Lyophilized recombinant human IL28B protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL28B protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human IL28B protein samples are stable below -20°C for 3 months. |