Cat#:RPH-NP229;Product Name:Recombinant Human Interleukin-22 / IL22 Protein;Synonym:Interleukin-22,IL-22,Cytokine Zcyto18,IL-10-related T-cell-derived-inducible factor,IL-TIF, IL22,ILTIF, ZCYTO18;Description:Recombinant Human Interleukin-22 Protein is produced in E.coli and the target gene encoding Ala34-Ile179 is expressed.;Source:E. coli;AA Sequence:MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLN FTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIK AIGELDLLFMSLRNACI;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Interleukin-22/IL22 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.;Stability:Recombinant Human Interleukin-22/IL22 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IL22 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL22 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human IL22 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;