Cat#:RPH-NP223;Product Name:Recombinant Human Interleukin-1α / IL1α Protein;Synonym:Interleukin-1 Alpha, IL-1 Alpha, Hematopoietin-1, IL1A, IL1F1;Description:Recombinant Human Interleukin-1 alpha Protein is produced in E.coli and the target gene encoding Ser113-Ala271 is expressed.;Source:E.coli;AA Sequence:SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDD AKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNL FIATKQDYWVCLAGGPPSITDFQILENQA;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Interleukin-1α/IL1α Protein was lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.;Stability:Recombinant Human Interleukin-1α/IL1α Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IL1α protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL1α protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human IL1α protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;