Cat#:RPH-NP220;Product Name:Recombinant Human Interleukin-18 / IL18 / IL1F4 Protein;Synonym:Interleukin-18, Iboctadekin, Interferon gamma-inducing factor, IFN-gamma-inducing factor, Interleukin-1 gamma, IL-1 gamma,GIF, IL-18, IL-1g, IL1F4, MGC12320;Description:Recombinant Human Interleukin-18 Protein is produced in Human Cells and the target gene encoding Tyr37-Asp193 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTIS VKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKE RDLFKLILKKEDELGDRSIMFTVQNEDVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Interleukin-18/IL18/IL1F4 Protein was lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.;Stability:Recombinant Human Interleukin-18/IL18/IL1F4 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IL18 Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL18 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human IL18 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;