• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human Interleukin-17F / IL17F Protein Online Inquiry

Cat#:RPH-NP219
Product Name:Recombinant Human Interleukin-17F / IL17F Protein
Synonym: Interleukin-17F; IL-17F; Cytokine ML-1; Interleukin-24; IL-24; IL17F; IL24
Description: Recombinant Human Interleukin-17F Protein is produced in Human Cells and the target gene encoding Arg31-Gln163 is expressed.
Source: Human Cells
AA Sequence: RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPS EVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIH RVQ
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin: < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation: Recombinant Human Interleukin-17F/IL17F Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Stability: Recombinant Human Interleukin-17F/IL17F Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution: Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage: For Lab Research Use Only
Storage: Lyophilized recombinant human IL17F Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL17F protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human IL17F protein samples are stable below -20°C for 3 months.

Online Inquiry

refresh