• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human Interleukin-17A / IL17A Protein Online Inquiry

Cat#:RPH-NP215
Product Name:Recombinant Human Interleukin-17A / IL17A Protein
Synonym: Interleukin-17A, IL-17, IL-17A, Cytotoxic T-Lymphocyte-Associated Antigen 8, CTLA-8, IL17A, CTLA8, IL17
Description: Recombinant Human Interleukin-17A Protein is produced in Human Cells and the target gene encoding Gly24-Ala155 is expressed with a His tag at the C-terminus.
Source: Human Cells
AA Sequence: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSV IWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHH VAVDHHHHHH
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin: < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation: Recombinant Human Interleukin-17A/IL17A Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Stability: Recombinant Human Interleukin-17A/IL17A Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution: Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage: For Lab Research Use Only
Storage: Lyophilized recombinant human IL17A Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL17A protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human IL17A protein samples are stable below -20°C for 3 months.

Online Inquiry

refresh