Cat#:RPH-NP214;Product Name:Recombinant Human Interleukin-17A / IL17A Protein;Synonym:Interleukin-17A, IL-17, IL-17A, Cytotoxic T-Lymphocyte-Associated Antigen 8, CTLA-8, IL17A, CTLA8, IL17;Description:Recombinant Human Interleukin-17A Protein is produced in E.coli and the target gene encoding Ile20-Ala155 is expressed.;Source:E.coli;AA Sequence:MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPE RYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVT PIVHHVA;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Bioactivity:ED50 is approximately 2 ng/ml. Specific Activity of 5 x 10^5 IU/mg.;Formulation:Recombinant Human Interleukin-17A/IL17A Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, pH 7.4.;Stability:Recombinant Human Interleukin-17A/IL17A Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IL17A Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL17A protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human IL17A protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;