Cat#:RPH-NP213;Product Name:Recombinant Human Interleukin-17A / F Heterodimer / IL17A & IL17F Protein;Synonym:IL‑17A/F Heterodimer,IL-17A&IL-17F; Heterodimer;Description:Recombinant Human IL-17A &IL-17F; Heterodimer Protein is produced in Human Cells and the target gene encoding Ile20-Ala155&Arg31-Gln163; is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:MTSTLPFSPQVSTPRSKFKRISSEFAATMTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSE DKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINA DGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAMTSTLPFSPQVS TPRSKFKRISSVLSIEFAATMTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPE SCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINA QGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Interleukin-17A/F Heterodimer/IL17A & IL17F Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human Interleukin-17A/F Heterodimer/IL17A & IL17F Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 4mM Hcl.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IL17A & IL17F Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL17A & IL17F protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human IL17A & IL17F protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;