• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human Interleukin-16 / IL16 Protein Online Inquiry

Cat#:RPH-NP212
Product Name:Recombinant Human Interleukin-16 / IL16 Protein
Synonym: Pro-Interleukin-16; Interleukin-16; IL-16; Lymphocyte Chemoattractant Factor; LCF; IL16
Description: Recombinant Human Interleukin-16 Protein is produced in E.coli and the target gene encoding Met1-Ser130 is expressed.
Source: E. coli
AA Sequence: MPDLNSSTDSAASASAASDVSVESTAEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIF KGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin: < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Bioactivity: The ED50 for this effect is less than 100 ng/mL, measured by its to chemoattract human CD4+ T-lymphocytes.
Formulation: Recombinant Human Interleukin-16/IL16 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.0.
Stability: Recombinant Human Interleukin-16/IL16 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution: Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage: For Lab Research Use Only
Storage: Lyophilized recombinant human IL16 Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL16 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human IL16 protein samples are stable below -20°C for 3 months.

Online Inquiry

refresh