Cat#:RPH-NP211;Product Name:Recombinant Human Interleukin-15 / IL15 Protein;Synonym:Interleukin-15, IL-15, IL15;Description:Recombinant Human Interleukin-15 Protein is produced in E.coli and the target gene encoding Asn49-Ser162 is expressed.;Source:E.coli;AA Sequence:NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVEN LIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Bioactivity:ED50 is less than 0.5 ng/ml. Specific Activity of 2.0 x 10^6 IU/mg.;Formulation:Recombinant Human Interleukin-15/IL15 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.0.;Stability:Recombinant Human Interleukin-15/IL15 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IL15 Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL15 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human IL15 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;