Cat#:RPH-NP207;Product Name:Recombinant Human Interleukin-11 / IL11 Protein;Synonym:Interleukin-11, IL-11, Adipogenesis Inhibitory Factor, AGIF, Oprelvekin, IL11;Description:Recombinant Human Interleukin-11 Protein is produced in Yeastand the target gene encoding Gly23-Leu199 is expressed.;Source:E. coli;AA Sequence:GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGA LQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQP PPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Bioactivity:ED50 is less than 0.2 ng/ml. Specific Activity of 8.0 x 10^6 IU/ mg, measured by the dose-dependent stimulation of murine 7TD1 proliferation.;Formulation:Recombinant Human Interleukin-11/IL11 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 2% Glycine, pH 7.2.;Stability:Recombinant Human Interleukin-11/IL11 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IL11 Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL11 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human IL11 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;