Cat#:RPH-NP205;Product Name:Recombinant Human Interleukin-10 / IL10 Protein;Synonym:Interleukin-10, IL-10, Cytokine synthesis inhibitory factor, CSIF, IL10, RP11-262N9.1, IL10A, MGC126450, MGC126451, TGIF;Description:Recombinant Human Interleukin-10 Protein is produced in Human Cells and the target gene encoding Ser19-Asn178 is expressed.;Source:Human Cells;AA Sequence:SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQAL SEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNK LQEKGIYKAMSEFDIFINYIEAYMTMKIRN;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Interleukin-10/IL10 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human Interleukin-10/IL10 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IL10 Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL10 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human IL10 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;