Cat#:RP-13076H;Product Name:Recombinant Human PLA2G2D Protein, His Tag;Synonym:phospholipase A2 group IID; SPLASH; sPLA2S; PLA2IID; sPLA2-IID; group IID secretory phospholipase A2; GIID sPLA2; phosphatidylcholine 2-acylhydrolase 2D; secretory phospholipase A2s; secretory-type PLA, stroma-associated homolog;Background:This gene encodes a secreted member of the phospholipase A2 family, and is found in a cluster of related family members on chromosome 1. Phospholipase A2 family members hydrolyze the sn-2 fatty acid ester bond of glycerophospholipids to produce lysophospholipids and free fatty acid. This gene may be involved in inflammation and immune response, and in weight loss associated with chronic obstructive pulmonary disease. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Nov 2012];Description:Recombinant Human PLA2G2D Protein, produced in E.coli was fused with a His tag. It is purified using our unique purification method. ;Source:E. coli;AA Sequence:LNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC ;Molecular Characterization:21 kDa;Stability:Recombinant Human PLA2G2D Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. ;Host Species:Human;Storage:Store the human PLA2G2D protein at 4°C within 2-4 weeks. Store at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.;References:The bactericidal effect of human secreted group IID phospholipase A2 results from both hydrolytic and non-hydrolytic activities. Fonseca-Maldonado R, et al. Biochimie, 2012 Jun. PMID 22490726;