Cat#: | RP-10699H |
Product Name: | Recombinant Human IGFBP1 Protein, GST Tag |
Source: | E. coli |
AA Sequence: | GLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSIPWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN |
Formulation: | Recombinant human IGFBP1 Protein was lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0) and 10% glycerol. |
Stability: | Recombinant human IGFBP1 Proteins are stable for up to 1 year from date of receipt at -70℃ |
Reconstitution: | Reconstitute recombinant human IGFBP1 protein at 0.25 µg/μl in 200 μl sterile water for short-term storage. |
Storage: | Store recombinant human IGFBP1 protein at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles. |
References: | Ekstrand J, Ehrenborg E, Stern I, et al. (1990). "The gene for insulin-like growth factor-binding protein-1 is localized to human chromosomal region 7p14-p12". Genomics. 6 (3): 413–8. |