• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human ERG Protein(GST Tag) Online Inquiry

Cat#:RP-9327HL
Product Name:Recombinant Human ERG Protein(GST Tag)
Synonym: p55; erg-3; ERG; ETS transcription factor
Gene Introduction: This gene encodes a member of the erythroblast transformation-specific (ETS) family of transcriptions factors. All members of this family are key regulators of embryonic development, cell proliferation, differentiation, angiogenesis, inflammation, and apoptosis. The protein encoded by this gene is mainly expressed in the nucleus. It contains an ETS DNA-binding domain and a PNT (pointed) domain which is implicated in the self-association of chimeric oncoproteins. This protein is required for platelet adhesion to the subendothelium, inducing vascular cell remodeling. It also regulates hematopoesis, and the differentiation and maturation of megakaryocytic cells. This gene is involved in chromosomal translocations, resulting in different fusion gene products, such as TMPSSR2-ERG and NDRG1-ERG in prostate cancer, EWS-ERG in Ewing's sarcoma and FUS-ERG in acute myeloid leukemia. More than two dozens of transcript variants generated from combinatorial usage of three alternative promoters and multiple alternative splicing events have been reported, but the full-length nature of many of these variants has not been determined. [provided by RefSeq, Apr 2014]
Description: Recombinant Human ERG partial ORF ( NP_891548, 1 a.a. - 100 a.a.) was fused with a GST tag at N-terminal.
Source: Wheat Germ (in vitro)
AA Sequence: MASTIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTV
Molecular Characterization: 36.74kDa
Formulation: The recombinant ERG protein was supplied in 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Host Species: Human
Application: ELISA, Protein Array, WB, Antibody Production
Usage: For Lab Research Use Only
Storage: Store human ERG protein at -80°C. Aliquot to avoid repeated freezing and thawing.
References: Phosphorylation of the oncogenic transcription factor ERG in prostate cells dissociates polycomb repressive complex 2, allowing target gene activation. Kedage V, et al. J Biol Chem, 2017 Oct 20. PMID 28887309

Online Inquiry

refresh